PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000059G1270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25036.7 Da    PI: 10.1696
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000059G1270genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF946.9e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++gklye++s
  PH01000059G1270  9 KRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 59
                     79***********************************************86 PP

2K-box63.11e-2178171598
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       ++++++++  + + ++  L k++e L+ ++R++lGe+Le +s +eLq+Le +L ksl +iR kK++ll +qi +l++ke+ l ++n++Lr+k 
  PH01000059G1270  78 ANNRTAQQDILQVKADAVSLAKKLEALEDSKRKILGENLEGCSAEELQSLEVKLGKSLHNIRVKKTQLLEQQIAKLKEKERTLLKDNEDLREKH 171
                      444577788888999999*************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002652.64E-40376No hitNo description
PRINTSPR004048.9E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-31381IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.0E-2383170IPR002487Transcription factor, K-box
PROSITE profilePS5129712.98987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRSGLLK KAFELSVLCD AEVALIVFSP RGKLYEFASA  60
TSLQKTIDRY KAHTKDNANN RTAQQDILQV KADAVSLAKK LEALEDSKRK ILGENLEGCS  120
AEELQSLEVK LGKSLHNIRV KKTQLLEQQI AKLKEKERTL LKDNEDLREK HRNLQAPLVV  180
PALSRMAPPR DVPEPSSNDM DVETELYIGL PGRDRTSNRE SG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-19373271Myocyte-specific enhancer factor 2A
3mu6_C4e-19373271Myocyte-specific enhancer factor 2A
3mu6_B4e-19373271Myocyte-specific enhancer factor 2A
3mu6_A4e-19373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915160.0FP091516.1 Phyllostachys edulis cDNA clone: bphylf032d21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-123PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-116MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-117C0P954_MAIZE; MADS transcription factor
STRINGSb01g030570.11e-118(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-70AGAMOUS-like 20